PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S01815.20
Common NameJCGZ_12348, LOC105639666
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family LBD
Protein Properties Length: 304aa    MW: 33925.9 Da    PI: 6.8649
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S01815.20genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.52.3e-4381071100
         DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                    +CaaCk+lrrkC+++Cv+apyfp +qp+kfa vhk+FGasnv kll++l+  +reda++sl+yeA+ r+rdPvyG+vg+i+ lq+ql+ql+ el++
  Jcr4S01815.20   8 PCAACKFLRRKCTQECVFAPYFPPDQPQKFASVHKVFGASNVAKLLNELNAAQREDAVNSLAYEADERLRDPVYGCVGLISVLQHQLKQLQGELHS 103
                    7**********************************************************************************************9 PP

         DUF260  97 lkee 100
                    +k+e
  Jcr4S01815.20 104 AKKE 107
                    9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.717108IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-438105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MSSSSNSPCA ACKFLRRKCT QECVFAPYFP PDQPQKFASV HKVFGASNVA KLLNELNAAQ  60
REDAVNSLAY EADERLRDPV YGCVGLISVL QHQLKQLQGE LHSAKKELSQ YIGPEAMAPI  120
PQQMFMPQHY MGNPSSSNVM AHNMFPMMGI PSGQLMIREH PQLAHQQQAH QQPAHQQPAQ  180
LHQHQLFEAQ HLTPTVATRD QQDFFRNFDP QQQQQDIVRF NSGFDASGSV TATGYNQLGG  240
GAAVSPSLAL GTYDNPYQIQ PQAEHHHHQL QAQLLLQPQQ QTQQTEQQHQ RSGNEEGRSM  300
GPSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012079177.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_012079178.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ32e-84LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A067K7020.0A0A067K702_JATCU; Uncharacterized protein
STRINGPOPTR_0007s11460.11e-121(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-84ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]